LXL04_003344 | RubberDandelionOmics

Gene overview

LXL04_003344

Reference: OH-1004 Chr: Chr01 Coordinates: 75634596-75651636 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5010 bp · LXL04_003344|LXL04_003344|OH1004|cDNA

ATGAGTCTCGGAGAAGGCACTCCCAGGCTTTCGTCTTCCCCACTCGATATCTCCCTGTCTCGCGTCTCACTCGGTCTCTCTTACCGGCGCGCAATGGAACAGCAGTGCCAATTGTTTGCTAAACCCGCGAAGTGGACTCTAATAGGCGGGAATCCTTCTTTTGAATCTACAGCAATCCCCACTGTTTTCAAAACCCTAATTCCATCCACCGTTTCTCTTCCTCCCGTGAACATTTACTTCCCGTCGATTCTcaagaaata...

CDS

Download CDS FASTA

5010 bp · LXL04_003344|LXL04_003344|OH1004|CDS

ATGAGTCTCGGAGAAGGCACTCCCAGGCTTTCGTCTTCCCCACTCGATATCTCCCTGTCTCGCGTCTCACTCGGTCTCTCTTACCGGCGCGCAATGGAACAGCAGTGCCAATTGTTTGCTAAACCCGCGAAGTGGACTCTAATAGGCGGGAATCCTTCTTTTGAATCTACAGCAATCCCCACTGTTTTCAAAACCCTAATTCCATCCACCGTTTCTCTTCCTCCCGTGAACATTTACTTCCCGTCGATTCTCAAGAAATA...

Protein

Download Protein FASTA

1669 aa · LXL04_003344|LXL04_003344|OH1004|PROTEIN

MSLGEGTPRLSSSPLDISLSRVSLGLSYRRAMEQQCQLFAKPAKWTLIGGNPSFESTAIPTVFKTLIPSTVSLPPVNIYFPSILKKYFFCMATTIEDDGKIDDSEMDVEVTVDDQERCRNVDDAGGVPSPHTLPLNHEQLELNMISSCSNAVLSTKGLLAEENENQEKEEERPDSINVDGVEEKNGVKKKRGRKKGWKANNRNTGTATKPQENKSKTRGRRKRVVALEKPMKTGVVKSSVDDNKSPEETDEGMVDAEAAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003344`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003344

Location Chr01:75634596-75651636 (-)

Description Similar to ANTR5: Probable anion transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44370`	Inorganic phosphate and probable anion transporter.	No verified direct reference in this release
`At1g11950`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression.	No verified direct reference in this release
`At1g62310`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0180100`	Probable anion transporter.	No verified direct reference in this release
`Os11g0186800`	Probable anion transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003344 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006811 monoatomic ion transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0048188 Set1C/COMPASS complex Cellular Component

GO:0003712 transcription coregulator activity Molecular Function

GO:0005315 phosphate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G11950

ath:AT5G44370

dosa:Os11g0186800

dosa:Os12g0180100

osa:4349969

osa:4351670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.438

Rank 1 · LXL04_003344 · OH-1004

Cell membrane0.184

Rank 2 · LXL04_003344 · OH-1004

Cytoplasm0.180

Rank 3 · LXL04_003344 · OH-1004

Endoplasmic reticulum0.177

Rank 4 · LXL04_003344 · OH-1004

Golgi apparatus0.080

Rank 5 · LXL04_003344 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02373.29JmjC1037-1135 aa

PF07690.22MFS_11251-1616 aa

PF00083.31Sugar_tr1259-1415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003344	`PF02373.29`	JmjC	1037	1135	1.2e-14	55.4
LXL04_003344	`PF07690.22`	MFS_1	1251	1616	3.5e-49	168.3
LXL04_003344	`PF00083.31`	Sugar_tr	1259	1415	7.5e-08	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKV1`	Arabidopsis thaliana	Probable anion transporter 5	76.716%	Swiss-Prot	weak database homology
`C0SUU8`	Arabidopsis thaliana	Lysine-specific demethylase JMJ26	44.403%	Swiss-Prot	weak database homology
`C0SV12`	Arabidopsis thaliana	Lysine-specific demethylase JMJ29	44.231%	Swiss-Prot	weak database homology
`Q2QWW7`	Oryza sativa subsp. japonica	Probable anion transporter 7	70.343%	Swiss-Prot	weak database homology
`Q53P54`	Oryza sativa subsp. japonica	Probable anion transporter 6	71.078%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card