LXL04_001281 | RubberDandelionOmics

Gene overview

LXL04_001281

Reference: OH-1004 Chr: Chr01 Coordinates: 23411888-23417210 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2871 bp · LXL04_001281|LXL04_001281|OH1004|cDNA

ATGGTCCGGCGGTGGTTCGGCAGTGGTccgatgtgccgatgggtgcaggtggtgcaccgacggtggtccggcggtggtccgatggtggtccggtggtggcggtggtccggcggtggaCTGACAGTGGTCCGTcagtggtccggcggtggtccgacagtggtccgatgtgccgatgggtgcaagtggtgcaccgacggtggtccagcggtggtccggcgggggtccgatggtggtccggcggtggtccggcagtggtccgg...

CDS

Download CDS FASTA

2871 bp · LXL04_001281|LXL04_001281|OH1004|CDS

ATGGTCCGGCGGTGGTTCGGCAGTGGTCCGATGTGCCGATGGGTGCAGGTGGTGCACCGACGGTGGTCCGGCGGTGGTCCGATGGTGGTCCGGTGGTGGCGGTGGTCCGGCGGTGGACTGACAGTGGTCCGTCAGTGGTCCGGCGGTGGTCCGACAGTGGTCCGATGTGCCGATGGGTGCAAGTGGTGCACCGACGGTGGTCCAGCGGTGGTCCGGCGGGGGTCCGATGGTGGTCCGGCGGTGGTCCGGCAGTGGTCCGG...

Protein

Download Protein FASTA

956 aa · LXL04_001281|LXL04_001281|OH1004|PROTEIN

MVRRWFGSGPMCRWVQVVHRRWSGGGPMVVRWWRWSGGGLTVVRQWSGGGPTVVRCADGCKWCTDGGPAVVRRGSDGGPAVVRQWSGSGPAVVRQWSDVPMGASGAPTVVRRWSDGGPVVGAGGGPVGADMSSSDQPSPSLSEASEEELMRLSLDLVAAAKQTIGFLRDVAESHWLHHTPVLVESVRRYHQLWMPMMADLTTEAGKPPMVFPSLDIEWVWFCHTLNPVSYREYCESRFSKLIGKPAIFNQENKDYALERC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001281`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001281

Location Chr01:23411888-23417210 (-)

Description Similar to GRDP1: Glycine-rich domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22660`	Plays a regulatory role in abscisic acid (ABA) signaling and tolerance to abiotic stress during germination.	No verified direct reference in this release
`At4g37900`	Involved in development and stress responses, probably through an auxin-dependent mechanism.	Overexpression of AtGRDP2, a novel glycine-rich domain protein, accelerates plant growth and improves stress tolerance.2014 · DOI: 10.3389/fpls.2014.00782

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:0071470 cellular response to osmotic stress Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G22660

ath:AT4G37900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.287

Rank 1 · LXL04_001281 · OH-1004

Nucleus0.266

Rank 2 · LXL04_001281 · OH-1004

Cell membrane0.218

Rank 3 · LXL04_001281 · OH-1004

Endoplasmic reticulum0.166

Rank 4 · LXL04_001281 · OH-1004

Golgi apparatus0.109

Rank 5 · LXL04_001281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07173.18GRDP-like144-231 aa

PF07173.18GRDP-like229-366 aa

PF25335.2GRDP_C599-756 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001281	`PF07173.18`	GRDP-like	144	231	2.1e-46	158.9
LXL04_001281	`PF07173.18`	GRDP-like	229	366	2.1e-46	158.9
LXL04_001281	`PF25335.2`	GRDP_C	599	756	8.8e-46	156.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ47`	Arabidopsis thaliana	Glycine-rich domain-containing protein 1	29.836%	Swiss-Prot	weak database homology
`Q9SZJ2`	Arabidopsis thaliana	Glycine-rich domain-containing protein 2	30.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card