LXL04_000402 | RubberDandelionOmics

Gene overview

LXL04_000402

Reference: OH-1004 Chr: Chr01 Coordinates: 7458122-7459421 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_000402|LXL04_000402|OH1004|cDNA

ATGATTTCTCCATCCACCATTAAAACCTGTTTGAAATCCTTCATCCGTCCAAATCTCCCCCACAAAAATCTGATGCCTCAATCTCCATCAACTACACGCTGCTTTCACCTCTCAATCGGATGTATCAAACCAAACTATACCCTAAAAACAACCTCCCACCACTCCTttatcaacaacaacaactggCAATTACTTTCCATCAAAAGTGGTATGCGATCCAGACGTGGCTCACAAAAGACACGCTTTGATCTCTCACTTGG...

CDS

Download CDS FASTA

948 bp · LXL04_000402|LXL04_000402|OH1004|CDS

ATGATTTCTCCATCCACCATTAAAACCTGTTTGAAATCCTTCATCCGTCCAAATCTCCCCCACAAAAATCTGATGCCTCAATCTCCATCAACTACACGCTGCTTTCACCTCTCAATCGGATGTATCAAACCAAACTATACCCTAAAAACAACCTCCCACCACTCCTTTATCAACAACAACAACTGGCAATTACTTTCCATCAAAAGTGGTATGCGATCCAGACGTGGCTCACAAAAGACACGCTTTGATCTCTCACTTGG...

Protein

Download Protein FASTA

315 aa · LXL04_000402|LXL04_000402|OH1004|PROTEIN

MISPSTIKTCLKSFIRPNLPHKNLMPQSPSTTRCFHLSIGCIKPNYTLKTTSHHSFINNNNWQLLSIKSGMRSRRGSQKTRFDLSLGSRNMNFRLLFPKQGIISRMKWSLVPGSWTQGCTSAGVVMGLTVCSSSSESSYVEAQENKEDDCSSSNNTNFSHGKQVHTDYSVIGIPGDGRCLFRAVAHGACIRSGKPTPSESLQRELADELRGRVADEFIKRREETEWFIEGDFDSYVSQMRKTHVWGGEPELLMASHVLKM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000402`
TK1151 ID	TkA01G614020
OH-1004 ID	LXL04_000402
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000402

Location Chr01:7458122-7459421 (+)

Description Similar to OTU4: OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57810`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	No verified direct reference in this release
`At2g38025`	Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation.	Distinct phylogenetic relationships and biochemical properties of Arabidopsis ovarian tumor-related deubiquitinases support their functional differentiation.2014 · DOI: 10.3389/fpls.2014.00084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000402 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0035523 protein K29-linked deubiquitination Biological Process

GO:0035871 protein K11-linked deubiquitination Biological Process

GO:0036503 ERAD pathway Biological Process

GO:1990167 protein K27-linked deubiquitination Biological Process

GO:1990168 protein K33-linked deubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38025

ath:AT3G57810

hsa:139562

xla:444600

xtr:496720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.614

Rank 1 · LXL04_000402 · OH-1004

Mitochondrion0.373

Rank 2 · LXL04_000402 · OH-1004

Nucleus0.061

Rank 3 · LXL04_000402 · OH-1004

Cytoplasm0.048

Rank 4 · LXL04_000402 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_000402 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02338.26OTU174-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000402	`PF02338.26`	OTU	174	300	1.4e-28	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBZ4`	Arabidopsis thaliana	OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4	67.391%	Swiss-Prot	moderate database homology
`Q8GYW0`	Arabidopsis thaliana	OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 3	33.962%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card