LXL04_000316 | RubberDandelionOmics

Gene overview

LXL04_000316

Reference: OH-1004 Chr: Chr01 Coordinates: 5887442-5889754 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_000316|LXL04_000316|OH1004|cDNA

ATGTCTCTTGAGGATTCATTAAGATCTCTCTCTCTAGACTATCTAAATCTACTGATCAACGGGCAAGCCTTCAGCGACGTCACTTTCAGCGTGGAGGGAAGAATCGTCCATGCCCACCGCTGCATCCTGGCTGCTCGCAGCCTGTtcttcagaaagttcttttGCTCCGGCGGCACCGACTCTCCGACGGGGTCTGGATCGGATCCGTTAGGGTCGAGGATGGGTGTGGGTATGGGTATGGGACCCGCTTCCCCCAGGAA...

CDS

Download CDS FASTA

1527 bp · LXL04_000316|LXL04_000316|OH1004|CDS

ATGTCTCTTGAGGATTCATTAAGATCTCTCTCTCTAGACTATCTAAATCTACTGATCAACGGGCAAGCCTTCAGCGACGTCACTTTCAGCGTGGAGGGAAGAATCGTCCATGCCCACCGCTGCATCCTGGCTGCTCGCAGCCTGTTCTTCAGAAAGTTCTTTTGCTCCGGCGGCACCGACTCTCCGACGGGGTCTGGATCGGATCCGTTAGGGTCGAGGATGGGTGTGGGTATGGGTATGGGACCCGCTTCCCCCAGGAA...

Protein

Download Protein FASTA

508 aa · LXL04_000316|LXL04_000316|OH1004|PROTEIN

MSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRIVHAHRCILAARSLFFRKFFCSGGTDSPTGSGSDPLGSRMGVGMGMGPASPRNSPSSQVVIPVNSVGYEVFLLMLQFLYSGQVSIVPQKHEPRPNCGERGCWHTHCTSAVDLALDTLSAARSFGVEQLVLLTQKQLAIMVEKASIEDVMKVLLASRKQDMHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSSIARRSLMPHHHQHHHHDLSVAADLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000316`
TK1151 ID	TkA01G620160
OH-1004 ID	LXL04_000316
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000316

Location Chr01:5887442-5889754 (-)

Description Similar to NPR5: Regulatory protein NPR5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41370`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	The BLADE ON PETIOLE genes act redundantly to control the growth and development of lateral organs.2005 · DOI: 10.1242/dev.01815 BLADE-ON-PETIOLE-dependent signaling controls leaf and floral patterning in Arabidopsis.2005 · DOI: 10.1105/tpc.104.030536 BLADE-ON-PETIOLE 1 and 2 control Arabidopsis lateral organ fate through regulation of LOB domain and adaxial-abaxial polarity genes.2007 · DOI: 10.1105/tpc.107.051938 The BLADE-ON-PETIOLE genes are essential for abscission zone formation in Arabidopsis.2008 · DOI: 10.1242/dev.012807 BLADE-ON-PETIOLE1 coordinates organ determinacy and axial polarity in arabidopsis by directly activating ASYMMETRIC LEAVES2.2010 · DOI: 10.1105/tpc.109.070763 Control of Arabidopsis leaf morphogenesis through regulation of the YABBY and KNOX families of transcription factors.2010 · DOI: 10.1534/genetics.110.118703 Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24.2010 · DOI: 10.1111/j.1365-313x.2010.04299.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0009877 nodulation Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009954 proximal/distal pattern formation Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010434 bract formation Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0010865 stipule development Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0048439 flower morphogenesis Biological Process

KEGG gene cross-reference

ath:AT2G41370

lang:109358814

mtr:11417633

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.563

Rank 1 · LXL04_000316 · OH-1004

Nucleus0.418

Rank 2 · LXL04_000316 · OH-1004

Cell membrane0.121

Rank 3 · LXL04_000316 · OH-1004

Lysosome / Vacuole0.069

Rank 4 · LXL04_000316 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_000316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB18-57 aa

PF11900.15DUF3420209-268 aa

PF12796.14Ank_2273-356 aa

PF00023.37Ank327-357 aa

PF13857.13Ank_5329-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000316	`PF00651.38`	BTB	18	57	1.4e-14	54.9
LXL04_000316	`PF11900.15`	DUF3420	209	268	1.1e-12	48.5
LXL04_000316	`PF12796.14`	Ank_2	273	356	7.1e-13	49.7
LXL04_000316	`PF00023.37`	Ank	327	357	7.9e-12	45.4
LXL04_000316	`PF13857.13`	Ank_5	329	366	7.4e-11	42.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVC2`	Arabidopsis thaliana	Regulatory protein NPR5	79.042%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card